PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009608073.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family CO-like
Protein Properties Length: 383aa    MW: 42184.3 Da    PI: 6.1789
Description CO-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009608073.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-B_box18.44.5e-062260440
        zf-B_box  4 rkCpeHeekelqlfCedCqqllCedClleeHkg..Htvv 40
                    + C+ ++   +  fC+++++++C  C +  H +  H++v
  XP_009608073.1 22 KPCEYCHLDAALVFCRTDNMFMCLGCDMRVHGNarHERV 60
                    57*****999*********************55889876 PP

2zf-B_box26.11.8e-0859105242
        zf-B_box   2 eerkCpeHeekelqlfCedCqqllCedClleeHkg......Htvvpl 42 
                     + ++C+ +e+  ++  C+ +   lC  C + +H+       H+++p+
  XP_009608073.1  59 RVWICEVCEQAAASVTCKADAAALCVACDSDIHSAnplaqrHERIPV 105
                     5689*******9*********************66899999998885 PP

3CCT69.87.1e-24307350144
             CCT   1 ReaallRYkeKrktRkFeKkirYesRKavAesRpRvKGrFvkqa 44 
                     Rea++lRY+eK+k+RkFeK+irY+sRKa+Ae+RpR+KGrF+k++
  XP_009608073.1 307 REARVLRYREKKKNRKFEKTIRYASRKAYAETRPRIKGRFAKRN 350
                     9*****************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003361.7E-61962IPR000315B-box-type zinc finger
CDDcd000215.22E-72362No hitNo description
PROSITE profilePS501198.8022462IPR000315B-box-type zinc finger
PROSITE profilePS5011910.70858105IPR000315B-box-type zinc finger
PfamPF006431.5E-659105IPR000315B-box-type zinc finger
CDDcd000211.82E-861105No hitNo description
SMARTSM003361.0E-863105IPR000315B-box-type zinc finger
PfamPF062038.3E-18307349IPR010402CCT domain
PROSITE profilePS5101716.638307349IPR010402CCT domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005622Cellular Componentintracellular
GO:0005515Molecular Functionprotein binding
GO:0008270Molecular Functionzinc ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 383 aa     Download sequence    Send to blast
MGILRGGSNC FPRGWGAAAV AKPCEYCHLD AALVFCRTDN MFMCLGCDMR VHGNARHERV  60
WICEVCEQAA ASVTCKADAA ALCVACDSDI HSANPLAQRH ERIPVVPFYD PVESVVKSTA  120
DTLLVSINNS NSLSTTMTMT TAEASDFSKV TACLGHHEED FNSDPWISPN TMTTNLPVNT  180
VEMKPMDFLF SDSENILDFD YSVSIDTNSQ PNYNSANDSV VPVQSTIKPL PFQYQEKHFE  240
IDFTQTHIKS YTTPSLSHSV SSSSLDVGIV PDGSSISEIS YPFGRSVNSS VEMGSSAQAE  300
KLIGMNREAR VLRYREKKKN RKFEKTIRYA SRKAYAETRP RIKGRFAKRN DSSGAGVDSD  360
IDQIYSCAGF IASDSRYGVV PSF
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009608073.10.0PREDICTED: zinc finger protein CONSTANS-LIKE 5
TrEMBLM1CMJ00.0M1CMJ0_SOLTU; Uncharacterized protein
STRINGPGSC0003DMT4000706800.0(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA10352376
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G57660.15e-98CONSTANS-like 5